PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_40966_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 84aa    MW: 9751.25 Da    PI: 9.5851
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_40966_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.33.1e-31959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +rienk nrqvtfskRrng+lKKA+ELS LCdaevaviifss+gkl+e++s
  Neem_40966_f_1  9 ERIENKVNRQVTFSKRRNGLLKKAYELSLLCDAEVAVIIFSSHGKLFEFAS 59
                    69***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.847161IPR002100Transcription factor, MADS-box
CDDcd002659.23E-38267No hitNo description
SuperFamilySSF554551.18E-30271IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-31323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.8E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MGRGKVVLER IENKVNRQVT FSKRRNGLLK KAYELSLLCD AEVAVIIFSS HGKLFEFASN  60
DVSELVYYIK SQREWEIGER TEKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-22166166Myocyte-specific enhancer factor 2B
1tqe_Q2e-22166166Myocyte-specific enhancer factor 2B
1tqe_R2e-22166166Myocyte-specific enhancer factor 2B
1tqe_S2e-22166166Myocyte-specific enhancer factor 2B
3mu6_A2e-22266165Myocyte-specific enhancer factor 2A
3mu6_B2e-22266165Myocyte-specific enhancer factor 2A
3mu6_C2e-22266165Myocyte-specific enhancer factor 2A
3mu6_D2e-22266165Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011030021.14e-34PREDICTED: truncated transcription factor CAULIFLOWER A-like
RefseqXP_011030020.14e-34PREDICTED: truncated transcription factor CAULIFLOWER A-like
SwissprotQ6EU398e-31MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLB9I4G96e-34B9I4G9_POPTR; Apetala1 family protein
TrEMBLU5FXL42e-33U5FXL4_POPTR; Uncharacterized protein
STRINGPOPTR_0015s14010.13e-31(Populus trichocarpa)
STRINGGLYMA20G29250.16e-31(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.33e-31MIKC_MADS family protein